SCOPe 2.06: Domain d5e4fa2: 5e4f A:326-625

Lineage for d5e4fa2 (5e4f A:326-625)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein automated matches [226986] (8 species)
   not a true protein

7. Species Hepatitis c virus genotype 1b (isolate con1) [TaxId:333284] [317410] (1 PDB entry)

8. Domain d5e4fa2: 5e4f A:326-625 [317503]
   Other proteins in same PDB: d5e4fa1, d5e4fb1
   automated match to d1cu1a3
   complexed with adp, alf, mg

Details for d5e4fa2

PDB Entry: 5e4f, 2.1 Å

PDB Description: the spring alpha-helix coordinates multiple modes of hcv ns3 helicase action

PDB Compounds: (A:) Serine protease NS3

SCOPe Domain Sequences for d5e4fa2:

Sequence; same for both SEQRES and ATOM records:

>d5e4fa2 c.37.1.14 (A:326-625) automated matches {Hepatitis c virus genotype 1b (isolate con1) [TaxId: 333284]}
pgsvtvphpnieevalsstgeipfygkaipietikggrhlifchskkkcdelaaklsglg
lnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevttthpitkyimacmsa

Timeline for d5e4fa2:

• d5e4fa2 is new in SCOPe 2.06-stable
  
• d5e4fa2 appears in SCOPe 2.07
  
• d5e4fa2 appears in the current release, SCOPe 2.08