Lineage for d1fsza1 (1fsz A:23-231)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361112Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361113Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1361114Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1361115Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1361127Species Methanococcus jannaschii [TaxId:2190] [52493] (7 PDB entries)
    Uniprot Q57816 23-360
  8. 1361136Domain d1fsza1: 1fsz A:23-231 [31750]
    Other proteins in same PDB: d1fsza2
    complexed with gdp

Details for d1fsza1

PDB Entry: 1fsz (more details), 2.8 Å

PDB Description: crystal structure of the cell-division protein ftsz at 2.8a resolution
PDB Compounds: (A:) ftsz

SCOPe Domain Sequences for d1fsza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsza1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl

SCOPe Domain Coordinates for d1fsza1:

Click to download the PDB-style file with coordinates for d1fsza1.
(The format of our PDB-style files is described here.)

Timeline for d1fsza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fsza2