SCOP 1.69: Domain d1fsz_1: 1fsz 23-231

Lineage for d1fsz_1 (1fsz 23-231)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)

6. Protein Cell-division protein FtsZ [52492] (3 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [52493] (1 PDB entry)

8. Domain d1fsz_1: 1fsz 23-231 [31750]
   Other proteins in same PDB: d1fsz_2

Details for d1fsz_1

PDB Entry: 1fsz, 2.8 Å

PDB Description: crystal structure of the cell-division protein ftsz at 2.8a resolution

SCOP Domain Sequences for d1fsz_1:

Sequence; same for both SEQRES and ATOM records:

>d1fsz_1 c.32.1.1 (23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl

Timeline for d1fsz_1:

• d1fsz_1 first appeared (with stable ids) in SCOP 1.55
  
• d1fsz_1 appears in SCOP 1.67
  
• d1fsz_1 appears in SCOP 1.71
  
• d1fsz_1 appears in the current release, SCOPe 2.08, called d1fsza1