Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein Cell-division protein FtsZ [52492] (9 species) |
Species Methanococcus jannaschii [TaxId:2190] [52493] (7 PDB entries) Uniprot Q57816 23-360 |
Domain d1fsza1: 1fsz A:23-231 [31750] Other proteins in same PDB: d1fsza2 complexed with gdp |
PDB Entry: 1fsz (more details), 2.8 Å
SCOPe Domain Sequences for d1fsza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsza1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]} spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm plklafkvadevlinavkglvelitkdgl
Timeline for d1fsza1: