Lineage for d5i3ka_ (5i3k A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2090066Protein automated matches [196175] (7 species)
    not a true protein
  7. 2090086Species Trypanosoma brucei [TaxId:5702] [271658] (9 PDB entries)
  8. 2090104Domain d5i3ka_: 5i3k A: [317499]
    automated match to d1tpfa_
    complexed with na, pga

Details for d5i3ka_

PDB Entry: 5i3k (more details), 2.21 Å

PDB Description: structure-function studies on role of hydrophobic clamping of a basic glutamate in catalysis by triosephosphate isomerase
PDB Compounds: (A:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d5i3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i3ka_ c.1.1.1 (A:) automated matches {Trypanosoma brucei [TaxId: 5702]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngfavggaslkpe
fvdiikatq

SCOPe Domain Coordinates for d5i3ka_:

Click to download the PDB-style file with coordinates for d5i3ka_.
(The format of our PDB-style files is described here.)

Timeline for d5i3ka_: