Lineage for d1e3ta_ (1e3t A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22757Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 22758Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (4 families) (S)
  5. 22794Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
  6. 22795Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 22801Species Rhodospirillum rubrum [TaxId:1085] [52488] (1 PDB entry)
  8. 22802Domain d1e3ta_: 1e3t A: [31749]

Details for d1e3ta_

PDB Entry: 1e3t (more details)

PDB Description: solution structure of the nadp(h) binding component (diii) of proton-translocating transhydrogenase from rhodospirillum rubrum

SCOP Domain Sequences for d1e3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ta_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
rsvkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpva
grmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiyg
mpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOP Domain Coordinates for d1e3ta_:

Click to download the PDB-style file with coordinates for d1e3ta_.
(The format of our PDB-style files is described here.)

Timeline for d1e3ta_: