Lineage for d1d4oa_ (1d4o A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828384Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 828385Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 828556Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
  6. 828557Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 828558Species Cow (Bos taurus) [TaxId:9913] [52487] (1 PDB entry)
  8. 828559Domain d1d4oa_: 1d4o A: [31748]

Details for d1d4oa_

PDB Entry: 1d4o (more details), 1.21 Å

PDB Description: crystal structure of transhydrogenase domain iii at 1.2 angstroms resolution
PDB Compounds: (A:) nadp(h) transhydrogenase

SCOP Domain Sequences for d1d4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus) [TaxId: 9913]}
gthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlseqgkkvrfgihpva
grmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpnsiiag
mpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvres

SCOP Domain Coordinates for d1d4oa_:

Click to download the PDB-style file with coordinates for d1d4oa_.
(The format of our PDB-style files is described here.)

Timeline for d1d4oa_: