SCOPe 2.08: Domain d5faxa2: 5fax A:318-433

Lineage for d5faxa2 (5fax A:318-433)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Bacillus halmapalus [TaxId:79882] [317441] (2 PDB entries)

8. Domain d5faxa2: 5fax A:318-433 [317479]
   Other proteins in same PDB: d5faxa1, d5faxb1
   automated match to d1wmda1
   complexed with ca

Details for d5faxa2

PDB Entry: 5fax, 2 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus

PDB Compounds: (A:) Subtilase SubHal from Bacillus halmapalus

SCOPe Domain Sequences for d5faxa2:

Sequence; same for both SEQRES and ATOM records:

>d5faxa2 b.18.1.0 (A:318-433) automated matches {Bacillus halmapalus [TaxId: 79882]}
afvnetsplstsqkatysftaqagkplkislvwsdapgsttasltlvndldlvitapngt
kyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynvpvgpqtfslaivh

Timeline for d5faxa2:

• d5faxa2 first appeared in SCOPe 2.06
  
• d5faxa2 appears in SCOPe 2.07