Lineage for d5faxa2 (5fax A:318-433)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2774997Species Bacillus halmapalus [TaxId:79882] [317441] (2 PDB entries)
  8. 2775000Domain d5faxa2: 5fax A:318-433 [317479]
    Other proteins in same PDB: d5faxa1, d5faxb1
    automated match to d1wmda1
    complexed with ca

Details for d5faxa2

PDB Entry: 5fax (more details), 2 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus
PDB Compounds: (A:) Subtilase SubHal from Bacillus halmapalus

SCOPe Domain Sequences for d5faxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5faxa2 b.18.1.0 (A:318-433) automated matches {Bacillus halmapalus [TaxId: 79882]}
afvnetsplstsqkatysftaqagkplkislvwsdapgsttasltlvndldlvitapngt
kyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynvpvgpqtfslaivh

SCOPe Domain Coordinates for d5faxa2:

Click to download the PDB-style file with coordinates for d5faxa2.
(The format of our PDB-style files is described here.)

Timeline for d5faxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5faxa1