Lineage for d1djlb_ (1djl B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483121Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 483122Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 483223Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
  6. 483224Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 483227Species Human (Homo sapiens) [TaxId:9606] [52486] (2 PDB entries)
  8. 483229Domain d1djlb_: 1djl B: [31747]

Details for d1djlb_

PDB Entry: 1djl (more details), 2 Å

PDB Description: the crystal structure of human transhydrogenase domain iii with bound nadp

SCOP Domain Sequences for d1djlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djlb_ c.31.1.4 (B:) Transhydrogenase domain III (dIII) {Human (Homo sapiens)}
pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
es

SCOP Domain Coordinates for d1djlb_:

Click to download the PDB-style file with coordinates for d1djlb_.
(The format of our PDB-style files is described here.)

Timeline for d1djlb_: