![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (14 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [272712] (16 PDB entries) |
![]() | Domain d5fc8e_: 5fc8 E: [317467] automated match to d1un0b_ |
PDB Entry: 5fc8 (more details), 2.1 Å
SCOPe Domain Sequences for d5fc8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fc8e_ a.118.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgk tdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgnia gdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldave qilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpiv tpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqi qqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnlls akdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasln liekyfs
Timeline for d5fc8e_: