| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Bacillus halmapalus [TaxId:79882] [317441] (2 PDB entries) |
| Domain d5faxb2: 5fax B:318-433 [317463] Other proteins in same PDB: d5faxa1, d5faxb1 automated match to d1wmda1 complexed with ca |
PDB Entry: 5fax (more details), 2 Å
SCOPe Domain Sequences for d5faxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5faxb2 b.18.1.0 (B:318-433) automated matches {Bacillus halmapalus [TaxId: 79882]}
afvnetsplstsqkatysftaqagkplkislvwsdapgsttasltlvndldlvitapngt
kyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynvpvgpqtfslaivh
Timeline for d5faxb2: