Lineage for d1bfd_1 (1bfd 182-341)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483121Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 483122Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 483145Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 483152Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 483153Species Pseudomonas putida [TaxId:303] [52483] (2 PDB entries)
  8. 483154Domain d1bfd_1: 1bfd 182-341 [31745]
    Other proteins in same PDB: d1bfd_2, d1bfd_3

Details for d1bfd_1

PDB Entry: 1bfd (more details), 1.6 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida

SCOP Domain Sequences for d1bfd_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfd_1 c.31.1.3 (182-341) Benzoylformate decarboxylase {Pseudomonas putida}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOP Domain Coordinates for d1bfd_1:

Click to download the PDB-style file with coordinates for d1bfd_1.
(The format of our PDB-style files is described here.)

Timeline for d1bfd_1: