SCOP 1.63: Domain d1bfd_1: 1bfd 182-341

Lineage for d1bfd_1 (1bfd 182-341)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (4 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Benzoylformate decarboxylase [52482] (1 species)

7. Species Pseudomonas putida [TaxId:303] [52483] (2 PDB entries)

8. Domain d1bfd_1: 1bfd 182-341 [31745]
   Other proteins in same PDB: d1bfd_2, d1bfd_3
   complexed with ca, mg, tpp

Details for d1bfd_1

PDB Entry: 1bfd, 1.6 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida

SCOP Domain Sequences for d1bfd_1:

Sequence; same for both SEQRES and ATOM records:

>d1bfd_1 c.31.1.3 (182-341) Benzoylformate decarboxylase {Pseudomonas putida}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

Timeline for d1bfd_1:

• d1bfd_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bfd_1 appears in SCOP 1.61
  
• d1bfd_1 appears in SCOP 1.65
  
• d1bfd_1 appears in the current release, SCOPe 2.08, called d1bfda1