![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (4 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Benzoylformate decarboxylase [52482] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [52483] (2 PDB entries) |
![]() | Domain d1bfd_1: 1bfd 182-341 [31745] Other proteins in same PDB: d1bfd_2, d1bfd_3 complexed with ca, mg, tpp |
PDB Entry: 1bfd (more details), 1.6 Å
SCOP Domain Sequences for d1bfd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfd_1 c.31.1.3 (182-341) Benzoylformate decarboxylase {Pseudomonas putida} svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d1bfd_1: