Lineage for d1bfd_1 (1bfd 182-341)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (4 families) 
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (3 proteins) Protein Benzoylformate decarboxylase [52482] (1 species) Species Pseudomonas putida [TaxId:303] [52483] (1 PDB entry) 
Domain d1bfd_1: 1bfd 182-341 [31745]
Other proteins in same PDB: d1bfd_2, d1bfd_3
Details for d1bfd_1
PDB Entry: 1bfd (more details), 1.6 Å
PDB Description: benzoylformate decarboxylase from pseudomonas putida
SCOP Domain Sequences for d1bfd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfd_1 c.31.1.3 (182-341) Benzoylformate decarboxylase {Pseudomonas putida}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap
SCOP Domain Coordinates for d1bfd_1:
Click to download the PDB-style file with coordinates for d1bfd_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bfd_1:
- d1bfd_1 appears in SCOP 1.57
- d1bfd_1 appears in the current release, SCOPe 2.08, called d1bfda1
View in 3D
