SCOPe 2.08: Domain d5fbza1: 5fbz A:1-317

Lineage for d5fbza1 (5fbz A:1-317)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (15 proteins)

6. Protein automated matches [190073] (16 species)
   not a true protein

7. Species Bacillus halmapalus [TaxId:79882] [317439] (2 PDB entries)

8. Domain d5fbza1: 5fbz A:1-317 [317440]
   Other proteins in same PDB: d5fbza2, d5fbzb_, d5fbzc2, d5fbzd1
   automated match to d1wmda2
   complexed with ca

Details for d5fbza1

PDB Entry: 5fbz, 1.9 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a

PDB Compounds: (A:) Enzyme subtilase SubHal from Bacillus halmapalus

SCOPe Domain Sequences for d5fbza1:

Sequence; same for both SEQRES and ATOM records:

>d5fbza1 c.41.1.1 (A:1-317) automated matches {Bacillus halmapalus [TaxId: 79882]}
xdvargivkadvaqnnfglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
nandpnghgthvagsvlgnatnkgmapqanlvfqsimdsggglgglpanlqtlfsqaysa
garihtnswgapvngayttdsrnvddyvrkndmtilfaagnegpgsgtisapgtaknait
vgatenlrpsfgsyadninhvaqfssrgptrdgrikpdvmapgtyilsarsslapdssfw
anhdskyaymggtsmatpivagnvaqlrehfvknrgvtpkpsllkaaliagaadvglgfp
ngnqgwgrvtldkslnv

Timeline for d5fbza1:

• d5fbza1 first appeared in SCOPe 2.06
  
• d5fbza1 appears in SCOPe 2.07