Lineage for d5fbzb_ (5fbz B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551816Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2551817Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2551818Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 2551871Protein automated matches [190792] (4 species)
    not a true protein
  7. 2551872Species Barley (Hordeum vulgare) [TaxId:4513] [317430] (8 PDB entries)
  8. 2551880Domain d5fbzb_: 5fbz B: [317431]
    Other proteins in same PDB: d5fbza1, d5fbza2, d5fbzc1, d5fbzc2
    automated match to d2ci2i_
    complexed with ca

Details for d5fbzb_

PDB Entry: 5fbz (more details), 1.9 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
PDB Compounds: (B:) subtilisin-chymotrypsin inhibitor-2a

SCOPe Domain Sequences for d5fbzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fbzb_ d.40.1.1 (B:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
rhnlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldni
aevprvg

SCOPe Domain Coordinates for d5fbzb_:

Click to download the PDB-style file with coordinates for d5fbzb_.
(The format of our PDB-style files is described here.)

Timeline for d5fbzb_: