![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
![]() | Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
![]() | Protein automated matches [195455] (14 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [316357] (11 PDB entries) |
![]() | Domain d5eb0b_: 5eb0 B: [317429] automated match to d4zhva_ complexed with so4 |
PDB Entry: 5eb0 (more details), 2.8 Å
SCOPe Domain Sequences for d5eb0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eb0b_ d.79.7.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} glsaeqiavlqeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdid kvrleghtdnygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktra grsenrrvaiivpae
Timeline for d5eb0b_: