SCOPe 2.08: Domain d5b3jf1: 5b3j F:1-106

Lineage for d5b3jf1 (5b3j F:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5b3jf1: 5b3j F:1-106 [317427]
   Other proteins in same PDB: d5b3je_, d5b3jf2, d5b3jh_, d5b3jl2
   automated match to d1a5fl1
   complexed with na

Details for d5b3jf1

PDB Entry: 5b3j, 2.9 Å

PDB Description: activation of nmda receptors and the mechanism of inhibition by ifenprodil

PDB Compounds: (F:) Fab, light chain

SCOPe Domain Sequences for d5b3jf1:

Sequence; same for both SEQRES and ATOM records:

>d5b3jf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslggkvtitckasqdinkyiawyqhkpgkgprlliqytstlqpdips
rftgsgsgrdysfsisnlepediaiyyclqydnlytfgggtqleik

Timeline for d5b3jf1:

• d5b3jf1 first appeared in SCOPe 2.06
  
• d5b3jf1 appears in SCOPe 2.07