SCOPe 2.06: Domain d5eb1d_: 5eb1 D:

Lineage for d5eb1d_ (5eb1 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (11 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [316357] (7 PDB entries)

8. Domain d5eb1d_: 5eb1 D: [317422]
   automated match to d4zhva_
   complexed with so4

Details for d5eb1d_

PDB Entry: 5eb1, 1.8 Å

PDB Description: the yfib-yfir complex

PDB Compounds: (D:) YfiB

SCOPe Domain Sequences for d5eb1d_:

Sequence; same for both SEQRES and ATOM records:

>d5eb1d_ d.79.7.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
qeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdidkvrleghtdn
ygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktragrsenrrvai
ivpa

Timeline for d5eb1d_:

• d5eb1d_ is new in SCOPe 2.06-stable
  
• d5eb1d_ appears in SCOPe 2.07
  
• d5eb1d_ appears in the current release, SCOPe 2.08