Lineage for d5eb1d_ (5eb1 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960712Species Pseudomonas aeruginosa [TaxId:208964] [316357] (11 PDB entries)
  8. 2960719Domain d5eb1d_: 5eb1 D: [317422]
    automated match to d4zhva_
    complexed with so4

Details for d5eb1d_

PDB Entry: 5eb1 (more details), 1.8 Å

PDB Description: the yfib-yfir complex
PDB Compounds: (D:) YfiB

SCOPe Domain Sequences for d5eb1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eb1d_ d.79.7.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
qeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdidkvrleghtdn
ygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktragrsenrrvai
ivpa

SCOPe Domain Coordinates for d5eb1d_:

Click to download the PDB-style file with coordinates for d5eb1d_.
(The format of our PDB-style files is described here.)

Timeline for d5eb1d_: