Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein automated matches [226986] (8 species) not a true protein |
Species Hepatitis C virus genotype 1b (isolate con1) [TaxId:333284] [317410] (1 PDB entry) |
Domain d5e4fb2: 5e4f B:326-625 [317411] Other proteins in same PDB: d5e4fa1, d5e4fb1 automated match to d1cu1a3 complexed with adp, alf, mg |
PDB Entry: 5e4f (more details), 2.1 Å
SCOPe Domain Sequences for d5e4fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e4fb2 c.37.1.14 (B:326-625) automated matches {Hepatitis C virus genotype 1b (isolate con1) [TaxId: 333284]} pgsvtvphpnieevalsstgeipfygkaipietikggrhlifchskkkcdelaaklsglg lnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidcntcvtqtvdfsldptft ietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfdssvlcecydagcawyelt paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevttthpitkyimacmsa
Timeline for d5e4fb2: