Lineage for d5e4fb2 (5e4f B:326-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478565Family c.37.1.14: RNA helicase [52724] (4 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2478644Protein automated matches [226986] (8 species)
    not a true protein
  7. 2478665Species Hepatitis C virus genotype 1b (isolate con1) [TaxId:333284] [317410] (1 PDB entry)
  8. 2478667Domain d5e4fb2: 5e4f B:326-625 [317411]
    Other proteins in same PDB: d5e4fa1, d5e4fb1
    automated match to d1cu1a3
    complexed with adp, alf, mg

Details for d5e4fb2

PDB Entry: 5e4f (more details), 2.1 Å

PDB Description: the spring alpha-helix coordinates multiple modes of hcv ns3 helicase action
PDB Compounds: (B:) Serine protease NS3

SCOPe Domain Sequences for d5e4fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e4fb2 c.37.1.14 (B:326-625) automated matches {Hepatitis C virus genotype 1b (isolate con1) [TaxId: 333284]}
pgsvtvphpnieevalsstgeipfygkaipietikggrhlifchskkkcdelaaklsglg
lnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevttthpitkyimacmsa

SCOPe Domain Coordinates for d5e4fb2:

Click to download the PDB-style file with coordinates for d5e4fb2.
(The format of our PDB-style files is described here.)

Timeline for d5e4fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5e4fb1