| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d5b3jl1: 5b3j L:1-106 [317404] Other proteins in same PDB: d5b3je_, d5b3jf2, d5b3jh_, d5b3jl2 automated match to d1a5fl1 complexed with na |
PDB Entry: 5b3j (more details), 2.9 Å
SCOPe Domain Sequences for d5b3jl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b3jl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslggkvtitckasqdinkyiawyqhkpgkgprlliqytstlqpdips
rftgsgsgrdysfsisnlepediaiyyclqydnlytfgggtqleik
Timeline for d5b3jl1:
View in 3DDomains from other chains: (mouse over for more information) d5b3je_, d5b3jf1, d5b3jf2, d5b3jh_ |