Lineage for d1qpbb1 (1qpb B:182-360)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121415Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 121416Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
  5. 121428Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (4 proteins)
  6. 121436Protein Pyruvate decarboxylase [52478] (3 species)
  7. 121437Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52480] (2 PDB entries)
  8. 121441Domain d1qpbb1: 1qpb B:182-360 [31740]
    Other proteins in same PDB: d1qpba2, d1qpba3, d1qpbb2, d1qpbb3

Details for d1qpbb1

PDB Entry: 1qpb (more details), 2.4 Å

PDB Description: pyruvate decarboyxlase from yeast (form b) complexed with pyruvamide

SCOP Domain Sequences for d1qpbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpbb1 c.31.1.3 (B:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)}
qtpidmslkpndaesekevidtilvlikdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
ktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavp

SCOP Domain Coordinates for d1qpbb1:

Click to download the PDB-style file with coordinates for d1qpbb1.
(The format of our PDB-style files is described here.)

Timeline for d1qpbb1: