![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries) |
![]() | Domain d5he1a3: 5he1 A:550-668 [317390] Other proteins in same PDB: d5he1a1, d5he1a2, d5he1b_, d5he1g_ automated match to d3krwa3 complexed with mg, zs2 |
PDB Entry: 5he1 (more details), 3.15 Å
SCOPe Domain Sequences for d5he1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5he1a3 b.55.1.0 (A:550-668) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp
Timeline for d5he1a3: