| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
| Protein automated matches [190464] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries) |
| Domain d5he1a1: 5he1 A:29-185 [317388] Other proteins in same PDB: d5he1a2, d5he1a3, d5he1b_, d5he1g_ automated match to d3v5wa1 complexed with mg, zs2 |
PDB Entry: 5he1 (more details), 3.15 Å
SCOPe Domain Sequences for d5he1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5he1a1 a.91.1.0 (A:29-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyee
ikkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqp
yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih
Timeline for d5he1a1: