Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries) |
Domain d5isma2: 5ism A:509-766 [317382] Other proteins in same PDB: d5isma1, d5ismb1 automated match to d1orva2 complexed with 6dg, na, nag |
PDB Entry: 5ism (more details), 2 Å
SCOPe Domain Sequences for d5isma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5isma2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslp
Timeline for d5isma2: