Lineage for d4zr6b_ (4zr6 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408112Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2408206Protein automated matches [190922] (2 species)
    not a true protein
  7. 2408207Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (33 PDB entries)
  8. 2408444Domain d4zr6b_: 4zr6 B: [317378]
    automated match to d3u8kd_
    complexed with 4qw

Details for d4zr6b_

PDB Entry: 4zr6 (more details), 2.6 Å

PDB Description: lymnaea stagnalis acetylcholine binding protein in complex with 3- [(4e)-4-[(3-methylimidazol-4-yl)methylene]-2,3-dihydropyrrol-5- yl]pyridine
PDB Compounds: (B:) acetylcholine-binding protein

SCOPe Domain Sequences for d4zr6b_:

Sequence, based on SEQRES records: (download)

>d4zr6b_ b.96.1.1 (B:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
radilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdrt
lawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrfs
cdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkns
vtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d4zr6b_ b.96.1.1 (B:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
radilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdrt
lawnsspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrfscd
vsgvdtesgatcrikigswthhsreisvdpseyfsqysrfeilvtqkknsvtysccpeay
edvevslnfrkk

SCOPe Domain Coordinates for d4zr6b_:

Click to download the PDB-style file with coordinates for d4zr6b_.
(The format of our PDB-style files is described here.)

Timeline for d4zr6b_: