Lineage for d5dd1l2 (5dd1 L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761531Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)
  8. 2761540Domain d5dd1l2: 5dd1 L:108-213 [317361]
    Other proteins in same PDB: d5dd1h2
    automated match to d4jg1l2

Details for d5dd1l2

PDB Entry: 5dd1 (more details), 1.6 Å

PDB Description: crystal structures in an anti-hiv antibody lineage from immunization of rhesus macaques
PDB Compounds: (L:) anti-hiv antibody dh570 fab light chain

SCOPe Domain Sequences for d5dd1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dd1l2 b.1.1.0 (L:108-213) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
ravaapsvfifppsedqvksgtvsvvcllnnfypreasvkwkvdgvlktgnsqesvteqd
skdntyslsstltlsntdyqshnvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5dd1l2:

Click to download the PDB-style file with coordinates for d5dd1l2.
(The format of our PDB-style files is described here.)

Timeline for d5dd1l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dd1l1