SCOP 1.67: Domain d1pydb1: 1pyd B:182-360

Lineage for d1pydb1 (1pyd B:182-360)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Pyruvate decarboxylase [52478] (3 species)
   rudiment domain with a variant fold, lacks FAD-binding

7. Species Brewer's yeast (Saccharomyces), uvarum strain [TaxId:230603] [52479] (1 PDB entry)

8. Domain d1pydb1: 1pyd B:182-360 [31736]
   Other proteins in same PDB: d1pyda2, d1pyda3, d1pydb2, d1pydb3
   complexed with mg, tdp

Details for d1pydb1

PDB Entry: 1pyd, 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution

SCOP Domain Sequences for d1pydb1:

Sequence, based on SEQRES records:

>d1pydb1 c.31.1.3 (B:182-360) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
ktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

Sequence, based on observed residues (ATOM records):

>d1pydb1 c.31.1.3 (B:182-360) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhs
dhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

Timeline for d1pydb1:

• d1pydb1 first appeared (with stable ids) in SCOP 1.55
  
• d1pydb1 appears in SCOP 1.65
  
• d1pydb1 appears in SCOP 1.69
  
• d1pydb1 appears in the current release, SCOPe 2.08