Lineage for d1pydb1 (1pyd B:182-360)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312760Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 312761Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 312779Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (5 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 312811Protein Pyruvate decarboxylase [52478] (3 species)
    rudiment domain with a variant fold, lacks FAD-binding
  7. 312817Species Brewer's yeast (Saccharomyces), uvarum strain [TaxId:230603] [52479] (1 PDB entry)
  8. 312819Domain d1pydb1: 1pyd B:182-360 [31736]
    Other proteins in same PDB: d1pyda2, d1pyda3, d1pydb2, d1pydb3
    complexed with mg, tdp

Details for d1pydb1

PDB Entry: 1pyd (more details), 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution

SCOP Domain Sequences for d1pydb1:

Sequence, based on SEQRES records: (download)

>d1pydb1 c.31.1.3 (B:182-360) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
ktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

Sequence, based on observed residues (ATOM records): (download)

>d1pydb1 c.31.1.3 (B:182-360) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhs
dhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

SCOP Domain Coordinates for d1pydb1:

Click to download the PDB-style file with coordinates for d1pydb1.
(The format of our PDB-style files is described here.)

Timeline for d1pydb1: