Lineage for d1pyda1 (1pyd A:182-360)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22757Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 22758Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (4 families) (S)
  5. 22770Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (3 proteins)
  6. 22774Protein Pyruvate decarboxylase [52478] (3 species)
  7. 22780Species Brewer's yeast (Saccharomyces), uvarum strain [TaxId:230603] [52479] (1 PDB entry)
  8. 22781Domain d1pyda1: 1pyd A:182-360 [31735]
    Other proteins in same PDB: d1pyda2, d1pyda3, d1pydb2, d1pydb3

Details for d1pyda1

PDB Entry: 1pyd (more details), 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution

SCOP Domain Sequences for d1pyda1:

Sequence, based on SEQRES records: (download)

>d1pyda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
ktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

Sequence, based on observed residues (ATOM records): (download)

>d1pyda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhs
dhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

SCOP Domain Coordinates for d1pyda1:

Click to download the PDB-style file with coordinates for d1pyda1.
(The format of our PDB-style files is described here.)

Timeline for d1pyda1: