![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (13 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50981] (29 PDB entries) |
![]() | Domain d5he1b_: 5he1 B: [317345] Other proteins in same PDB: d5he1a1, d5he1a2, d5he1a3, d5he1g_ automated match to d3v5wb_ complexed with mg, zs2 |
PDB Entry: 5he1 (more details), 3.15 Å
SCOPe Domain Sequences for d5he1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5he1b_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam hwgtdsrllvsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk adragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d5he1b_:
![]() Domains from other chains: (mouse over for more information) d5he1a1, d5he1a2, d5he1a3, d5he1g_ |