Lineage for d4zijb_ (4zij B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133602Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2133603Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
    the insert subdomain is a 4-helical bundle
  7. 2133613Species Escherichia coli [TaxId:562] [100955] (17 PDB entries)
  8. 2133630Domain d4zijb_: 4zij B: [317335]
    automated match to d1a23a_
    complexed with edo, sfq

Details for d4zijb_

PDB Entry: 4zij (more details), 1.78 Å

PDB Description: crystal structure of e.coli dsba in complex with 2-(4- iodophenylsulfonamido) benzoic acid
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d4zijb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zijb_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOPe Domain Coordinates for d4zijb_:

Click to download the PDB-style file with coordinates for d4zijb_.
(The format of our PDB-style files is described here.)

Timeline for d4zijb_: