![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
![]() | Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
![]() | Protein automated matches [190464] (3 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [317242] (4 PDB entries) |
![]() | Domain d5he0a1: 5he0 A:30-185 [317323] Other proteins in same PDB: d5he0a2, d5he0a3, d5he0b_, d5he0g_ automated match to d3v5wa1 complexed with 453 |
PDB Entry: 5he0 (more details), 2.56 Å
SCOPe Domain Sequences for d5he0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5he0a1 a.91.1.0 (A:30-185) automated matches {Cow (Bos taurus) [TaxId: 9913]} kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyeei kkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqpy ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih
Timeline for d5he0a1: