SCOP 1.59: Domain d1poxb1: 1pox B:183-365

Lineage for d1poxb1 (1pox B:183-365)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (4 proteins)

6. Protein Pyruvate oxidase [52476] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [52477] (2 PDB entries)

8. Domain d1poxb1: 1pox B:183-365 [31732]
   Other proteins in same PDB: d1poxa2, d1poxa3, d1poxb2, d1poxb3

Details for d1poxb1

PDB Entry: 1pox, 2.1 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum

SCOP Domain Sequences for d1poxb1:

Sequence; same for both SEQRES and ATOM records:

>d1poxb1 c.31.1.3 (B:183-365) Pyruvate oxidase {Lactobacillus plantarum}
yasannyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

Timeline for d1poxb1:

• d1poxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1poxb1 appears in SCOP 1.57
  
• d1poxb1 appears in SCOP 1.61
  
• d1poxb1 appears in the current release, SCOPe 2.08