| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Zika virus [TaxId:64320] [317280] (7 PDB entries) |
| Domain d5jhmb2: 5jhm B:304-405 [317318] Other proteins in same PDB: d5jhma1, d5jhmb1 automated match to d4gsxa2 |
PDB Entry: 5jhm (more details), 2 Å
SCOPe Domain Sequences for d5jhmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhmb2 b.1.18.0 (B:304-405) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgs
Timeline for d5jhmb2: