Lineage for d5je8d1 (5je8 D:1-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846051Species Bacillus cereus [TaxId:226900] [189455] (5 PDB entries)
  8. 2846062Domain d5je8d1: 5je8 D:1-163 [317310]
    Other proteins in same PDB: d5je8a2, d5je8b2, d5je8b3, d5je8c2, d5je8d2
    automated match to d1yb4a1
    complexed with epe, gol, nad

Details for d5je8d1

PDB Entry: 5je8 (more details), 2.1 Å

PDB Description: the crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with nad
PDB Compounds: (D:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5je8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5je8d1 c.2.1.0 (D:1-163) automated matches {Bacillus cereus [TaxId: 226900]}
mkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsisklaetcdv
vftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkvdflaap
vsggvigaenrtltfmvggskdvyektesimgvlganifhvse

SCOPe Domain Coordinates for d5je8d1:

Click to download the PDB-style file with coordinates for d5je8d1.
(The format of our PDB-style files is described here.)

Timeline for d5je8d1: