![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
![]() | Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
![]() | Family a.52.1.0: automated matches [254196] (1 protein) not a true family |
![]() | Protein automated matches [254428] (8 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [317297] (1 PDB entry) |
![]() | Domain d2n81a_: 2n81 A: [317298] automated match to d2mala_ |
PDB Entry: 2n81 (more details)
SCOPe Domain Sequences for d2n81a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n81a_ a.52.1.0 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} alscgtvsadlapcvtylqapnnasppppccagvkkllaaatttpdrqaacnclksaags ipklntnnaaalpgkcgvsipykiststncntvrf
Timeline for d2n81a_: