Lineage for d5j92c_ (5j92 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2405395Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2405396Protein automated matches [191281] (16 species)
    not a true protein
  7. 2405400Species Burkholderia xenovorans [TaxId:266265] [314895] (3 PDB entries)
  8. 2405407Domain d5j92c_: 5j92 C: [317292]
    automated match to d1otjc_
    complexed with act, fe2

Details for d5j92c_

PDB Entry: 5j92 (more details), 1.95 Å

PDB Description: crystal structure of a putative alpha-ketoglutarate dependent 2,4-d dioxygenase from burkholderia xenovorans
PDB Compounds: (C:) Putative alpha KG dependent 2,4-D dioxygenase

SCOPe Domain Sequences for d5j92c_:

Sequence, based on SEQRES records: (download)

>d5j92c_ b.82.2.0 (C:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
slnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidddqllafaag
fgplqvavsystrpedhrlapmindisnlskenqtyrpgdrrrmnnltsrrwhsdasylp
lparysfllsyivpavggqtqfadmraaydklpdhlrkvveglschydimasraaagfyd
asdeerkalapcihelvrthpisgrkslylsshathvvgwpepegrdllreltefatqpq
fvyshewsvrdlvmwdnralmhrgrphipetdvremhrattlddrtwtr

Sequence, based on observed residues (ATOM records): (download)

>d5j92c_ b.82.2.0 (C:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
slnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidddqllafaag
fgplqvavdrrrmnnltsrrwhsdasylplparysfllsyivpavggqtqfadmraaydk
lpdhlrkvveglschydimasraaagfydasdeerkalapcihelvrthpisgrkslyls
shathvvgwpepegrdllreltefatqpqfvyshewsvrdlvmwdnralmhrgrphipet
dvremhrattlddrtwtr

SCOPe Domain Coordinates for d5j92c_:

Click to download the PDB-style file with coordinates for d5j92c_.
(The format of our PDB-style files is described here.)

Timeline for d5j92c_: