Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (11 species) not a true protein |
Species Zika virus [TaxId:64320] [317278] (7 PDB entries) |
Domain d5jhma1: 5jhm A:1-303 [317287] Other proteins in same PDB: d5jhma2, d5jhmb2 automated match to d4gsxa1 |
PDB Entry: 5jhm (more details), 2 Å
SCOPe Domain Sequences for d5jhma1:
Sequence, based on SEQRES records: (download)
>d5jhma1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]} ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl kgv
>d5jhma1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]} ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa cskkmtgksiqpenleyrimlsvhgsenrakveitpnspraeatlggfgslgldceprtg ldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdahakrqtv vvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgv
Timeline for d5jhma1: