Lineage for d5je8a2 (5je8 A:164-291)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721544Species Bacillus cereus [TaxId:226900] [317275] (1 PDB entry)
  8. 2721545Domain d5je8a2: 5je8 A:164-291 [317286]
    Other proteins in same PDB: d5je8a1, d5je8b1, d5je8b3, d5je8c1, d5je8d1
    automated match to d1yb4a2
    complexed with epe, gol, nad

Details for d5je8a2

PDB Entry: 5je8 (more details), 2.1 Å

PDB Description: the crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with nad
PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5je8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5je8a2 a.100.1.0 (A:164-291) automated matches {Bacillus cereus [TaxId: 226900]}
qidsgttvklinnlligfytagvsealtlakknnmdldkmfdilnvsygqsriyernyks
fiapenyepgftvnllkkdlgfavdlakeselhlpvsemllnvydeasqagygendmaal
ykkvseql

SCOPe Domain Coordinates for d5je8a2:

Click to download the PDB-style file with coordinates for d5je8a2.
(The format of our PDB-style files is described here.)

Timeline for d5je8a2: