| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Bacillus cereus [TaxId:226900] [189455] (5 PDB entries) |
| Domain d5je8a1: 5je8 A:1-163 [317285] Other proteins in same PDB: d5je8a2, d5je8b2, d5je8b3, d5je8c2, d5je8d2 automated match to d1yb4a1 complexed with epe, gol, nad |
PDB Entry: 5je8 (more details), 2.1 Å
SCOPe Domain Sequences for d5je8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5je8a1 c.2.1.0 (A:1-163) automated matches {Bacillus cereus [TaxId: 226900]}
mkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsisklaetcdv
vftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkvdflaap
vsggvigaenrtltfmvggskdvyektesimgvlganifhvse
Timeline for d5je8a1: