Lineage for d5jhla2 (5jhl A:304-403)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376421Species Zika virus [TaxId:64320] [317280] (7 PDB entries)
  8. 2376434Domain d5jhla2: 5jhl A:304-403 [317281]
    Other proteins in same PDB: d5jhla1, d5jhll1, d5jhll2
    automated match to d4gsxa2

Details for d5jhla2

PDB Entry: 5jhl (more details), 3 Å

PDB Description: crystal structure of zika virus envelope protein in complex with a flavivirus broadly-protective antibody
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d5jhla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhla2 b.1.18.0 (A:304-403) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrs

SCOPe Domain Coordinates for d5jhla2:

Click to download the PDB-style file with coordinates for d5jhla2.
(The format of our PDB-style files is described here.)

Timeline for d5jhla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jhla1