Lineage for d1efva2 (1efv A:208-331)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121415Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 121416Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
  5. 121421Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
  6. 121422Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (2 species)
  7. 121423Species Human (Homo sapiens) [TaxId:9606] [52473] (1 PDB entry)
  8. 121424Domain d1efva2: 1efv A:208-331 [31728]
    Other proteins in same PDB: d1efva1, d1efvb1

Details for d1efva2

PDB Entry: 1efv (more details), 2.1 Å

PDB Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution

SCOP Domain Sequences for d1efva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens)}
drpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtg
kivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemt
eilk

SCOP Domain Coordinates for d1efva2:

Click to download the PDB-style file with coordinates for d1efva2.
(The format of our PDB-style files is described here.)

Timeline for d1efva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efva1
View in 3D
Domains from other chains:
(mouse over for more information)
d1efvb1