SCOPe 2.07: Domain d5je8b1: 5je8 B:1-163

Lineage for d5je8b1 (5je8 B:1-163)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [189455] (5 PDB entries)

8. Domain d5je8b1: 5je8 B:1-163 [317274]
   Other proteins in same PDB: d5je8a2, d5je8b2, d5je8b3, d5je8c2, d5je8d2
   automated match to d1yb4a1
   complexed with epe, gol, nad

Details for d5je8b1

PDB Entry: 5je8, 2.1 Å

PDB Description: the crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with nad

PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5je8b1:

Sequence; same for both SEQRES and ATOM records:

>d5je8b1 c.2.1.0 (B:1-163) automated matches {Bacillus cereus [TaxId: 226900]}
mkkigfiglgnmglpmsknlvksgytvygvdlnkeaeasfekeggiiglsisklaetcdv
vftslpspraveavyfgaeglfenghsnvvfidtstvspqlnkqleeaakekkvdflaap
vsggvigaenrtltfmvggskdvyektesimgvlganifhvse

Timeline for d5je8b1:

• d5je8b1 first appeared in SCOPe 2.06
  
• d5je8b1 appears in the current release, SCOPe 2.08