Lineage for d1auxb1 (1aux B:112-213)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69114Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 69115Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 69223Family c.30.1.5: Synapsin Ia domain [52463] (1 protein)
  6. 69224Protein Synapsin Ia domain [52464] (1 species)
  7. 69225Species Cow (Bos taurus) [TaxId:9913] [52465] (2 PDB entries)
  8. 69229Domain d1auxb1: 1aux B:112-213 [31726]
    Other proteins in same PDB: d1auxa2, d1auxb2

Details for d1auxb1

PDB Entry: 1aux (more details), 2.3 Å

PDB Description: structure of the c domain of synapsin ia from bovine brain with calcium atp-gamma-s bound

SCOP Domain Sequences for d1auxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auxb1 c.30.1.5 (B:112-213) Synapsin Ia domain {Cow (Bos taurus)}
aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsi

SCOP Domain Coordinates for d1auxb1:

Click to download the PDB-style file with coordinates for d1auxb1.
(The format of our PDB-style files is described here.)

Timeline for d1auxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1auxb2