SCOP 1.55: Domain d1auxa1: 1aux A:112-213

Lineage for d1auxa1 (1aux A:112-213)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.5: Synapsin Ia domain [52463] (1 protein)

6. Protein Synapsin Ia domain [52464] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52465] (2 PDB entries)

8. Domain d1auxa1: 1aux A:112-213 [31725]
   Other proteins in same PDB: d1auxa2, d1auxb2

Details for d1auxa1

PDB Entry: 1aux, 2.3 Å

PDB Description: structure of the c domain of synapsin ia from bovine brain with calcium atp-gamma-s bound

SCOP Domain Sequences for d1auxa1:

Sequence; same for both SEQRES and ATOM records:

>d1auxa1 c.30.1.5 (A:112-213) Synapsin Ia domain {Cow (Bos taurus)}
aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsi

Timeline for d1auxa1:

• d1auxa1 appears in SCOP 1.57
  
• d1auxa1 appears in the current release, SCOPe 2.08