Lineage for d5a0yb1 (5a0y B:2-188)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955084Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
    C-terminal domain is all-alpha
  6. 2955145Protein automated matches [315351] (3 species)
    not a true protein
  7. 2955146Species Methanothermobacter marburgensis [TaxId:145263] [315352] (2 PDB entries)
  8. 2955148Domain d5a0yb1: 5a0y B:2-188 [317247]
    Other proteins in same PDB: d5a0ya2, d5a0yb2, d5a0yc_, d5a0yd2, d5a0ye2, d5a0yf_
    automated match to d1hbnb2
    complexed with cl, com, f43, k, mg, na, tp7

Details for d5a0yb1

PDB Entry: 5a0y (more details), 1.1 Å

PDB Description: methyl-coenzyme m reductase from methanothermobacter marburgensis at 1.1 a resolution
PDB Compounds: (B:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d5a0yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a0yb1 d.58.31.2 (B:2-188) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOPe Domain Coordinates for d5a0yb1:

Click to download the PDB-style file with coordinates for d5a0yb1.
(The format of our PDB-style files is described here.)

Timeline for d5a0yb1: