![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries) |
![]() | Domain d5dd3l1: 5dd3 L:1-106 [317240] Other proteins in same PDB: d5dd3h2 automated match to d4oawa1 |
PDB Entry: 5dd3 (more details), 1.8 Å
SCOPe Domain Sequences for d5dd3l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dd3l1 b.1.1.0 (L:1-106) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} diqvtqspsslsasvgdtvtiscrtsqtistwlawyqvkpgkapklliytasslesgvps rfsgsgsgtdftltistlqsedfatyycqqyislpptfglgtkvei
Timeline for d5dd3l1: