Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.5: Synapsin domain [52463] (2 proteins) automatically mapped to Pfam PF02078 |
Protein Synapsin I [52464] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [52465] (2 PDB entries) |
Domain d1auvb1: 1auv B:110-213 [31724] Other proteins in same PDB: d1auva2, d1auvb2 |
PDB Entry: 1auv (more details), 2.15 Å
SCOPe Domain Sequences for d1auvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auvb1 c.30.1.5 (B:110-213) Synapsin I {Cow (Bos taurus) [TaxId: 9913]} gaaarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlr ngvkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsi
Timeline for d1auvb1: