SCOPe 2.06: Domain d1auvb1: 1auv B:110-213

Lineage for d1auvb1 (1auv B:110-213)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.5: Synapsin domain [52463] (2 proteins)
   automatically mapped to Pfam PF02078

6. Protein Synapsin I [52464] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52465] (2 PDB entries)

8. Domain d1auvb1: 1auv B:110-213 [31724]
   Other proteins in same PDB: d1auva2, d1auvb2

Details for d1auvb1

PDB Entry: 1auv, 2.15 Å

PDB Description: structure of the c domain of synapsin ia from bovine brain

PDB Compounds: (B:) synapsin ia

SCOPe Domain Sequences for d1auvb1:

Sequence; same for both SEQRES and ATOM records:

>d1auvb1 c.30.1.5 (B:110-213) Synapsin I {Cow (Bos taurus) [TaxId: 9913]}
gaaarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlr
ngvkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsi

Timeline for d1auvb1:

• d1auvb1 first appeared (with stable ids) in SCOP 1.55
  
• d1auvb1 appears in SCOPe 2.05
  
• d1auvb1 appears in SCOPe 2.07
  
• d1auvb1 appears in the current release, SCOPe 2.08